PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 279aa    MW: 31626.6 Da    PI: 8.3406
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61622.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding537.6e-172973147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rW++eE+ ++++a k++G   W++I +++g ++t+ q++s+ qk+
       EPS61622.1 29 RERWSEEEHSRFLEALKLHGRA-WRKIEEHIG-TKTAVQIRSHAQKF 73
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.68E-162376IPR009057Homeodomain-like
PROSITE profilePS5129419.9022478IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-92676IPR009057Homeodomain-like
TIGRFAMsTIGR015579.6E-162776IPR006447Myb domain, plants
SMARTSM007171.3E-102876IPR001005SANT/Myb domain
PfamPF002497.2E-142972IPR001005SANT/Myb domain
CDDcd001672.52E-93174No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MDIEEQQSKY PTDEFAPKAR KPYTITKQRE RWSEEEHSRF LEALKLHGRA WRKIEEHIGT  60
KTAVQIRSHA QKFFCKVIRD DDTVEIPPPR PKRKPIHPYP RKLVSPVKGG ETLVPEKQMS  120
QSPKSILSAV GSSDSFDDDQ SPSSASSPAA ISDDHESVQA LHSDEDEFSS HEERHNPLEL  180
AARRAKEFNG RCLKLFGQTL CIVETDDDHL LLPLRVIPLK LTPLSKTSPW LSLSINAPDA  240
VNYDHSIKLS KCRSTTNSSN FGKKGFMPYR RSIATTEQS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790907.12e-51PREDICTED: protein REVEILLE 1-like isoform X1
TrEMBLS8DPD40.0S8DPD4_9LAMI; Uncharacterized protein
STRINGPGSC0003DMT4000552635e-50(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31852447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.12e-34MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]